Lineage for d1l6ea_ (1l6e A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767906Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 767907Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family) (S)
    dimer of identical alpha-hairpin motifs
  5. 767908Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins)
  6. 767913Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)
  7. 767914Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries)
  8. 767933Domain d1l6ea_: 1l6e A: [73607]

Details for d1l6ea_

PDB Entry: 1l6e (more details)

PDB Description: solution structure of the docking and dimerization domain of protein kinase a ii-alpha (riialpha d/d). alternatively called the n-terminal dimerization domain of the regulatory subunit of protein kinase a.
PDB Compounds: (A:) cAMP-dependent protein kinase Type II-alpha regulatory chain

SCOP Domain Sequences for d1l6ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ea_ a.31.1.1 (A:) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

SCOP Domain Coordinates for d1l6ea_:

Click to download the PDB-style file with coordinates for d1l6ea_.
(The format of our PDB-style files is described here.)

Timeline for d1l6ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l6eb_