SCOP 1.71: Domain d1l6ea_: 1l6e A:

Lineage for d1l6ea_ (1l6e A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit [47391] (1 family)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit [47392] (1 protein)

6. Protein Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit [47393] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47394] (2 PDB entries)

8. Domain d1l6ea_: 1l6e A: [73607]

Details for d1l6ea_

PDB Entry: 1l6e

PDB Description: solution structure of the docking and dimerization domain of protein kinase a ii-alpha (riialpha d/d). alternatively called the n-terminal dimerization domain of the regulatory subunit of protein kinase a.

SCOP Domain Sequences for d1l6ea_:

Sequence; same for both SEQRES and ATOM records:

>d1l6ea_ a.31.1.1 (A:) Dimerization-anchoring domain of cAMP-dependent type II PK regulatory subunit {Mouse (Mus musculus)}
hmghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr

Timeline for d1l6ea_:

• d1l6ea_ first appeared in SCOP 1.61
  
• d1l6ea_ appears in SCOP 1.69
  
• d1l6ea_ appears in SCOP 1.73
  
• d1l6ea_ appears in the current release, SCOPe 2.08, called d1l6ea1