SCOPe 2.07: Domain d1l5tb_: 1l5t B:

Lineage for d1l5tb_ (1l5t B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53890] (21 PDB entries)

8. Domain d1l5tb_: 1l5t B: [73602]
   N-terminal lobe
   mutant

Details for d1l5tb_

PDB Entry: 1l5t, 3 Å

PDB Description: crystal structure of a domain-opened mutant (r121d) of the human lactoferrin n-lobe refined from a merohedrally-twinned crystal form.

PDB Compounds: (B:) lactoferrin

SCOPe Domain Sequences for d1l5tb_:

Sequence; same for both SEQRES and ATOM records:

>d1l5tb_ c.94.1.2 (B:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
rsvqwcavsqpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtldggf
iyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrdta
gwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkcaf
ssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvdkfk
dchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfkds
aigfsrvppridsglylgsgyftaiqnlr

Timeline for d1l5tb_:

• d1l5tb_ first appeared in SCOP 1.61
  
• d1l5tb_ appears in SCOPe 2.06
  
• d1l5tb_ appears in the current release, SCOPe 2.08