Lineage for d1l5pc_ (1l5p C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894041Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1894042Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 1894148Species Trichomonas vaginalis [TaxId:5722] [75365] (1 PDB entry)
  8. 1894151Domain d1l5pc_: 1l5p C: [73600]
    complexed with fes

Details for d1l5pc_

PDB Entry: 1l5p (more details), 2.2 Å

PDB Description: Crystal Structure of Trichomonas vaginalis Ferredoxin
PDB Compounds: (C:) ferredoxin

SCOPe Domain Sequences for d1l5pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5pc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]}
gtitavkggvkkqlkfeddqtlftvlteaglmsaddtcqgnkacgkcickhvsgkvaaae
ddekefledqpanarlacaitlsgendgavfel

SCOPe Domain Coordinates for d1l5pc_:

Click to download the PDB-style file with coordinates for d1l5pc_.
(The format of our PDB-style files is described here.)

Timeline for d1l5pc_: