SCOPe 2.01: Domain d1l5jb2: 1l5j B:161-372

Lineage for d1l5jb2 (1l5j B:161-372)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.1: LeuD-like [52017] (4 proteins)
   Pfam PF00694; permutation of the domain order in the proteins containing this family domain

6. Protein Aconitase B, second N-terminal domain [75135] (1 species)

7. Species Escherichia coli [TaxId:562] [75136] (1 PDB entry)

8. Domain d1l5jb2: 1l5j B:161-372 [73596]
   Other proteins in same PDB: d1l5ja1, d1l5ja3, d1l5jb1, d1l5jb3
   complexed with f3s, tra

Details for d1l5jb2

PDB Entry: 1l5j, 2.4 Å

PDB Description: crystal structure of e. coli aconitase b.

PDB Compounds: (B:) Aconitate hydratase 2

SCOPe Domain Sequences for d1l5jb2:

Sequence; same for both SEQRES and ATOM records:

>d1l5jb2 c.8.2.1 (B:161-372) Aconitase B, second N-terminal domain {Escherichia coli [TaxId: 562]}
alaekltvtvfkvtgetntddlspapdawsrpdiplhalamlknaregiepdqpgvvgpi
kqiealqqkgfplayvgdvvgtgssrksatnsvlwfmgddiphvpnkrggglclggkiap
iffntmedagalpievdvsnlnmgdvidvypykgevrnhetgellatfelktdvlidevr
aggripliigrglttkarealglphsdvfrqa

Timeline for d1l5jb2:

• d1l5jb2 first appeared in SCOP 1.61
  
• d1l5jb2 appears in SCOP 1.75
  
• d1l5jb2 appears in SCOPe 2.02
  
• d1l5jb2 appears in the current release, SCOPe 2.08