Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.2: Aconitase [52016] (1 family) contains mixed beta-sheet barrel, closed n=7, S=10 |
Family c.8.2.1: Aconitase [52017] (2 proteins) permutation of the domain order |
Protein Aconitase B, second N-terminal domain [75135] (1 species) |
Species Escherichia coli [TaxId:562] [75136] (1 PDB entry) |
Domain d1l5jb2: 1l5j B:161-372 [73596] Other proteins in same PDB: d1l5ja1, d1l5ja3, d1l5jb1, d1l5jb3 |
PDB Entry: 1l5j (more details), 2.4 Å
SCOP Domain Sequences for d1l5jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5jb2 c.8.2.1 (B:161-372) Aconitase B, second N-terminal domain {Escherichia coli} alaekltvtvfkvtgetntddlspapdawsrpdiplhalamlknaregiepdqpgvvgpi kqiealqqkgfplayvgdvvgtgssrksatnsvlwfmgddiphvpnkrggglclggkiap iffntmedagalpievdvsnlnmgdvidvypykgevrnhetgellatfelktdvlidevr aggripliigrglttkarealglphsdvfrqa
Timeline for d1l5jb2: