SCOP 1.69: Domain d1l5jb2: 1l5j B:161-372

Lineage for d1l5jb2 (1l5j B:161-372)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: Aconitase [52016] (1 family)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.1: Aconitase [52017] (2 proteins)
   permutation of the domain order

6. Protein Aconitase B, second N-terminal domain [75135] (1 species)

7. Species Escherichia coli [TaxId:562] [75136] (1 PDB entry)

8. Domain d1l5jb2: 1l5j B:161-372 [73596]
   Other proteins in same PDB: d1l5ja1, d1l5ja3, d1l5jb1, d1l5jb3

Details for d1l5jb2

PDB Entry: 1l5j, 2.4 Å

PDB Description: crystal structure of e. coli aconitase b.

SCOP Domain Sequences for d1l5jb2:

Sequence; same for both SEQRES and ATOM records:

>d1l5jb2 c.8.2.1 (B:161-372) Aconitase B, second N-terminal domain {Escherichia coli}
alaekltvtvfkvtgetntddlspapdawsrpdiplhalamlknaregiepdqpgvvgpi
kqiealqqkgfplayvgdvvgtgssrksatnsvlwfmgddiphvpnkrggglclggkiap
iffntmedagalpievdvsnlnmgdvidvypykgevrnhetgellatfelktdvlidevr
aggripliigrglttkarealglphsdvfrqa

Timeline for d1l5jb2:

• d1l5jb2 first appeared in SCOP 1.61
  
• d1l5jb2 appears in SCOP 1.67
  
• d1l5jb2 appears in SCOP 1.71
  
• d1l5jb2 appears in the current release, SCOPe 2.08