Lineage for d1l5jb1 (1l5j B:1-160)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 217343Superfamily a.118.15: Aconitase B, N-terminal domain [74778] (1 family) (S)
  5. 217344Family a.118.15.1: Aconitase B, N-terminal domain [74779] (1 protein)
  6. 217345Protein Aconitase B, N-terminal domain [74780] (1 species)
  7. 217346Species Escherichia coli [TaxId:562] [74781] (1 PDB entry)
  8. 217348Domain d1l5jb1: 1l5j B:1-160 [73595]
    Other proteins in same PDB: d1l5ja2, d1l5ja3, d1l5jb2, d1l5jb3
    complexed with f3s, tra

Details for d1l5jb1

PDB Entry: 1l5j (more details), 2.4 Å

PDB Description: crystal structure of e. coli aconitase b.

SCOP Domain Sequences for d1l5jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5jb1 a.118.15.1 (B:1-160) Aconitase B, N-terminal domain {Escherichia coli}
mleeyrkhvaeraaegiapkpldanqmaalvellknppageeeflldlltnrvppgvdea
ayvkagflaaiakgeaksplltpekaiellgtmqggynihplidalddaklapiaakals
htllmfdnfydveekakagneyakqvmqswadaewflnrp

SCOP Domain Coordinates for d1l5jb1:

Click to download the PDB-style file with coordinates for d1l5jb1.
(The format of our PDB-style files is described here.)

Timeline for d1l5jb1: