![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.15: Aconitase B, N-terminal domain [74778] (1 family) ![]() automatically mapped to Pfam PF11791 |
![]() | Family a.118.15.1: Aconitase B, N-terminal domain [74779] (1 protein) |
![]() | Protein Aconitase B, N-terminal domain [74780] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [74781] (1 PDB entry) |
![]() | Domain d1l5jb1: 1l5j B:1-160 [73595] Other proteins in same PDB: d1l5ja2, d1l5ja3, d1l5jb2, d1l5jb3 complexed with f3s, tra |
PDB Entry: 1l5j (more details), 2.4 Å
SCOPe Domain Sequences for d1l5jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5jb1 a.118.15.1 (B:1-160) Aconitase B, N-terminal domain {Escherichia coli [TaxId: 562]} mleeyrkhvaeraaegiapkpldanqmaalvellknppageeeflldlltnrvppgvdea ayvkagflaaiakgeaksplltpekaiellgtmqggynihplidalddaklapiaakals htllmfdnfydveekakagneyakqvmqswadaewflnrp
Timeline for d1l5jb1: