Lineage for d1l5ja3 (1l5j A:373-862)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141742Fold c.83: Aconitase iron-sulfur domain [53731] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2141743Superfamily c.83.1: Aconitase iron-sulfur domain [53732] (1 family) (S)
  5. 2141744Family c.83.1.1: Aconitase iron-sulfur domain [53733] (4 protein domains)
    duplication: consists of three structurally similar subdomains with subdomains 1 and 3 being related by pseudo twofold symmetry
  6. 2141763Protein Aconitase B, C-terminal domain [75319] (1 species)
  7. 2141764Species Escherichia coli [TaxId:562] [75320] (1 PDB entry)
  8. 2141765Domain d1l5ja3: 1l5j A:373-862 [73594]
    Other proteins in same PDB: d1l5ja1, d1l5ja2, d1l5jb1, d1l5jb2
    complexed with f3s, tra

Details for d1l5ja3

PDB Entry: 1l5j (more details), 2.4 Å

PDB Description: crystal structure of e. coli aconitase b.
PDB Compounds: (A:) Aconitate hydratase 2

SCOPe Domain Sequences for d1l5ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5ja3 c.83.1.1 (A:373-862) Aconitase B, C-terminal domain {Escherichia coli [TaxId: 562]}
kdvaesdrgfslaqkmvgracgvkgirpgaycepkmtsvgsqdttgpmtrdelkdlaclg
fsadlvmqsfchtaaypkpvdvnthhtlpdfimnrggvslrpgdgvihswlnrmllpdtv
gtggdshtrfpigisfpagsglvafaaatgvmpldmpesvlvrfkgkmqpgitlrdlvha
iplyaikqglltvekkgkknifsgrileieglpdlkveqafeltdasaersaagctikln
kepiieylnsnivllkwmiaegygdrrtlerriqgmekwlanpelleadadaeyaavidi
dladikepilcapndpddarplsavqgekidevfigscmtnighfraagklldahkgqlp
trlwvapptrmdaaqlteegyysvfgksgarieipgcslcmgnqarvadgatvvststrn
fpnrlgtganvflasaelaavaaligklptpeeyqtyvaqvdktavdtyrylnfnqlsqy
tekadgvifq

SCOPe Domain Coordinates for d1l5ja3:

Click to download the PDB-style file with coordinates for d1l5ja3.
(The format of our PDB-style files is described here.)

Timeline for d1l5ja3: