Lineage for d1l5ja2 (1l5j A:161-372)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176798Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 176826Superfamily c.8.2: Aconitase [52016] (1 family) (S)
  5. 176827Family c.8.2.1: Aconitase [52017] (2 proteins)
  6. 176846Protein Aconitase B, second N-terminal domain [75135] (1 species)
  7. 176847Species Escherichia coli [TaxId:562] [75136] (1 PDB entry)
  8. 176848Domain d1l5ja2: 1l5j A:161-372 [73593]
    Other proteins in same PDB: d1l5ja1, d1l5ja3, d1l5jb1, d1l5jb3

Details for d1l5ja2

PDB Entry: 1l5j (more details), 2.4 Å

PDB Description: crystal structure of e. coli aconitase b.

SCOP Domain Sequences for d1l5ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5ja2 c.8.2.1 (A:161-372) Aconitase B, second N-terminal domain {Escherichia coli}
alaekltvtvfkvtgetntddlspapdawsrpdiplhalamlknaregiepdqpgvvgpi
kqiealqqkgfplayvgdvvgtgssrksatnsvlwfmgddiphvpnkrggglclggkiap
iffntmedagalpievdvsnlnmgdvidvypykgevrnhetgellatfelktdvlidevr
aggripliigrglttkarealglphsdvfrqa

SCOP Domain Coordinates for d1l5ja2:

Click to download the PDB-style file with coordinates for d1l5ja2.
(The format of our PDB-style files is described here.)

Timeline for d1l5ja2: