Lineage for d1l5gb5 (1l5g B:563-605)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202990Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 203221Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 203222Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 203223Species Human (Homo sapiens) [TaxId:9606] [69942] (4 PDB entries)
  8. 203229Domain d1l5gb5: 1l5g B:563-605 [73589]
    Other proteins in same PDB: d1l5ga1, d1l5ga2, d1l5ga3, d1l5ga4, d1l5gb1, d1l5gb2, d1l5gb3

Details for d1l5gb5

PDB Entry: 1l5g (more details), 3.2 Å

PDB Description: crystal structure of the extracellular segment of integrin avb3 in complex with an arg-gly-asp ligand

SCOP Domain Sequences for d1l5gb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5gb5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens)}
rtdtcmssngllcsgrgkcecgscvciqpgsygdtcekcptcp

SCOP Domain Coordinates for d1l5gb5:

Click to download the PDB-style file with coordinates for d1l5gb5.
(The format of our PDB-style files is described here.)

Timeline for d1l5gb5: