Lineage for d1l5eb_ (1l5e B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407676Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 2407677Superfamily b.89.1: Cyanovirin-N [51322] (2 families) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
    automatically mapped to Pfam PF08881
  5. 2407678Family b.89.1.1: Cyanovirin-N [51323] (2 protein domains)
  6. 2407679Protein Cyanovirin-N [51324] (1 species)
  7. 2407680Species Nostoc ellipsosporum [TaxId:45916] [51325] (18 PDB entries)
  8. 2407717Domain d1l5eb_: 1l5e B: [73580]
    swapped dimer

Details for d1l5eb_

PDB Entry: 1l5e (more details)

PDB Description: The domain-swapped dimer of CV-N in solution
PDB Compounds: (B:) Cyanovirin-N

SCOPe Domain Sequences for d1l5eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5eb_ b.89.1.1 (B:) Cyanovirin-N {Nostoc ellipsosporum [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqpsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

SCOPe Domain Coordinates for d1l5eb_:

Click to download the PDB-style file with coordinates for d1l5eb_.
(The format of our PDB-style files is described here.)

Timeline for d1l5eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l5ea_