SCOPe 2.05: Domain d1l4wa_: 1l4w A:

Lineage for d1l4wa_ (1l4w A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein Bungarotoxin [57324] (4 species)

7. Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (23 PDB entries)

8. Domain d1l4wa_: 1l4w A: [73570]
   complexed with an ACHR peptide, chain B

Details for d1l4wa_

PDB Entry: 1l4w

PDB Description: nmr structure of an achr-peptide (torpedo californica, alpha-subunit residues 182-202) in complex with alpha-bungarotoxin

PDB Compounds: (A:) alpha-bungarotoxin

SCOPe Domain Sequences for d1l4wa_:

Sequence; same for both SEQRES and ATOM records:

>d1l4wa_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

Timeline for d1l4wa_:

• d1l4wa_ first appeared in SCOP 1.61
  
• d1l4wa_ appears in SCOPe 2.04
  
• d1l4wa_ appears in SCOPe 2.06
  
• d1l4wa_ appears in the current release, SCOPe 2.08