Lineage for d1l4ua_ (1l4u A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.2: Shikimate kinase (AroK) [52566] (1 protein) Protein Shikimate kinase (AroK) [52567] (3 species) 
Species Mycobacterium tuberculosis [TaxId:1773] [75194] (2 PDB entries) 
Domain d1l4ua_: 1l4u A: [73568]
Details for d1l4ua_
PDB Entry: 1l4u (more details), 1.8 Å
PDB Description: crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and pt(ii) at 1.8 angstrom resolution
SCOP Domain Sequences for d1l4ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l4ua_ c.37.1.2 (A:) Shikimate kinase (AroK) {Mycobacterium tuberculosis}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl
SCOP Domain Coordinates for d1l4ua_:
Click to download the PDB-style file with coordinates for d1l4ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l4ua_:
- d1l4ua_ is new in SCOP 1.61
- d1l4ua_ appears in SCOP 1.63
- d1l4ua_ appears in the current release, SCOPe 2.08
View in 3D