Lineage for d1l4ib1 (1l4i B:1-120)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038156Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2038157Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 2038212Protein Periplasmic chaperone SfaE [74860] (1 species)
  7. 2038213Species Escherichia coli [TaxId:562] [74861] (1 PDB entry)
  8. 2038215Domain d1l4ib1: 1l4i B:1-120 [73566]
    Other proteins in same PDB: d1l4ia2, d1l4ib2

Details for d1l4ib1

PDB Entry: 1l4i (more details), 2.2 Å

PDB Description: Crystal Structure of the Periplasmic Chaperone SfaE
PDB Compounds: (B:) SfaE PROTEIN

SCOPe Domain Sequences for d1l4ib1:

Sequence, based on SEQRES records: (download)

>d1l4ib1 b.1.11.1 (B:1-120) Periplasmic chaperone SfaE {Escherichia coli [TaxId: 562]}
gvalgatrviypegqkqvqlavtnnddkssyliqswienaegkkdarfvitpplfsmqgk
kentlriidatngqmpedreslfwvnvkaipamdkaktgenylqfaivsrikllyrpqgl

Sequence, based on observed residues (ATOM records): (download)

>d1l4ib1 b.1.11.1 (B:1-120) Periplasmic chaperone SfaE {Escherichia coli [TaxId: 562]}
gvalgatrviypegqkqvqlavtnnddkssyliqswienaegkkdarfvitpplfsmqgk
kentlriidatngqmpedreslfwvnvkaipamqfaivsrikllyrpqgl

SCOPe Domain Coordinates for d1l4ib1:

Click to download the PDB-style file with coordinates for d1l4ib1.
(The format of our PDB-style files is described here.)

Timeline for d1l4ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l4ib2