SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1l4ia2 (1l4i A:121-205)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038309Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2038310Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 protein domains)
  6. 2038387Protein SfaE [74881] (1 species)
  7. 2038388Species Escherichia coli [TaxId:562] [74882] (1 PDB entry)
  8. 2038389Domain d1l4ia2: 1l4i A:121-205 [73565]
    Other proteins in same PDB: d1l4ia1, d1l4ib1

Details for d1l4ia2

PDB Entry: 1l4i (more details), 2.2 Å

PDB Description: Crystal Structure of the Periplasmic Chaperone SfaE
PDB Compounds: (A:) SfaE PROTEIN

SCOPe Domain Sequences for d1l4ia2:

Sequence, based on SEQRES records: (download)

>d1l4ia2 b.7.2.1 (A:121-205) SfaE {Escherichia coli [TaxId: 562]}
vippeqapgkleftrenggltlfnptpyyltvtdlkagnkslentmvppqgkvtvnipgg
ytggdityktindygalteqvrgvv

Sequence, based on observed residues (ATOM records): (download)

>d1l4ia2 b.7.2.1 (A:121-205) SfaE {Escherichia coli [TaxId: 562]}
vippeqapgkleftreltlfnptpyyltvtdlkagnkslentmvppqgkvtvniggdity
ktindygalteqvrgvv

SCOPe Domain Coordinates for d1l4ia2:

Click to download the PDB-style file with coordinates for d1l4ia2.
(The format of our PDB-style files is described here.)

Timeline for d1l4ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l4ia1