Lineage for d1l4ia2 (1l4i A:121-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2773233Protein SfaE [74881] (1 species)
  7. 2773234Species Escherichia coli [TaxId:562] [74882] (1 PDB entry)
  8. 2773235Domain d1l4ia2: 1l4i A:121-205 [73565]
    Other proteins in same PDB: d1l4ia1, d1l4ib1

Details for d1l4ia2

PDB Entry: 1l4i (more details), 2.2 Å

PDB Description: Crystal Structure of the Periplasmic Chaperone SfaE
PDB Compounds: (A:) SfaE PROTEIN

SCOPe Domain Sequences for d1l4ia2:

Sequence, based on SEQRES records: (download)

>d1l4ia2 b.7.2.1 (A:121-205) SfaE {Escherichia coli [TaxId: 562]}
vippeqapgkleftrenggltlfnptpyyltvtdlkagnkslentmvppqgkvtvnipgg
ytggdityktindygalteqvrgvv

Sequence, based on observed residues (ATOM records): (download)

>d1l4ia2 b.7.2.1 (A:121-205) SfaE {Escherichia coli [TaxId: 562]}
vippeqapgkleftreltlfnptpyyltvtdlkagnkslentmvppqgkvtvniggdity
ktindygalteqvrgvv

SCOPe Domain Coordinates for d1l4ia2:

Click to download the PDB-style file with coordinates for d1l4ia2.
(The format of our PDB-style files is described here.)

Timeline for d1l4ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l4ia1