SCOPe 2.05: Domain d1l4ab_: 1l4a B:

Lineage for d1l4ab_ (1l4a B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Syntaxin 1A [88908] (3 species)

7. Species Longfin inshore squid (Loligo pealei) [TaxId:6621] [88910] (1 PDB entry)

8. Domain d1l4ab_: 1l4a B: [73560]
   Other proteins in same PDB: d1l4aa_, d1l4ac_, d1l4ad_, d1l4ae_
   complex with SNAP25, synaptobrevin and synaphin fragments

Details for d1l4ab_

PDB Entry: 1l4a, 2.95 Å

PDB Description: x-ray structure of the neuronal complexin/snare complex from the squid loligo pealei

PDB Compounds: (B:) s-syntaxin

SCOPe Domain Sequences for d1l4ab_:

Sequence; same for both SEQRES and ATOM records:

>d1l4ab_ h.1.15.1 (B:) Syntaxin 1A {Longfin inshore squid (Loligo pealei) [TaxId: 6621]}
gksasgiimetqqakqtladiearhadimkletsirelhdmfmdmamlvesqgemidrie
ynveaavdyietakvdtkkavk

Timeline for d1l4ab_:

• d1l4ab_ first appeared in SCOP 1.61
  
• d1l4ab_ appears in SCOPe 2.04
  
• d1l4ab_ is called d1l4ab1 in SCOPe 2.06
  
• d1l4ab_ appears in the current release, SCOPe 2.08, called d1l4ab1