![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
![]() | Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
![]() | Protein Synaptobrevin [88903] (3 species) |
![]() | Species Longfin inshore squid (Loligo pealei) [TaxId:6621] [88905] (1 PDB entry) |
![]() | Domain d1l4aa_: 1l4a A: [73559] Other proteins in same PDB: d1l4ab1, d1l4ab2, d1l4ac_, d1l4ad_, d1l4ae_ complex with SNAP25, syntaxin and synaphin fragments |
PDB Entry: 1l4a (more details), 2.95 Å
SCOPe Domain Sequences for d1l4aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l4aa_ h.1.15.1 (A:) Synaptobrevin {Longfin inshore squid (Loligo pealei) [TaxId: 6621]} qpvqqskrlqqtqaqveevvdimrvnvdkvlerdskiselddradalqagasqfeasagk lkrkfw
Timeline for d1l4aa_: