SCOPe 2.08: Domain d1l4aa_: 1l4a A:

Lineage for d1l4aa_ (1l4a A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Synaptobrevin [88903] (3 species)

7. Species Longfin inshore squid (Loligo pealei) [TaxId:6621] [88905] (1 PDB entry)

8. Domain d1l4aa_: 1l4a A: [73559]
   Other proteins in same PDB: d1l4ab1, d1l4ab2, d1l4ac_, d1l4ad_, d1l4ae_
   complex with SNAP25, syntaxin and synaphin fragments

Details for d1l4aa_

PDB Entry: 1l4a, 2.95 Å

PDB Description: x-ray structure of the neuronal complexin/snare complex from the squid loligo pealei

PDB Compounds: (A:) synaptobrevin

SCOPe Domain Sequences for d1l4aa_:

Sequence; same for both SEQRES and ATOM records:

>d1l4aa_ h.1.15.1 (A:) Synaptobrevin {Longfin inshore squid (Loligo pealei) [TaxId: 6621]}
qpvqqskrlqqtqaqveevvdimrvnvdkvlerdskiselddradalqagasqfeasagk
lkrkfw

Timeline for d1l4aa_:

• d1l4aa_ first appeared in SCOP 1.61
  
• d1l4aa_ appears in SCOPe 2.07