Lineage for d1l3ya1 (1l3y A:1-40)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2583266Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 2583267Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 2583268Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries)
    Uniprot P05106 27-716
  8. 2583277Domain d1l3ya1: 1l3y A:1-40 [73558]
    Other proteins in same PDB: d1l3ya2
    EGF-like module 3

Details for d1l3ya1

PDB Entry: 1l3y (more details)

PDB Description: integrin egf-like module 3 from the beta-2 subunit
PDB Compounds: (A:) Integrin beta-2:CYSTEINE-RICH MODULE 3

SCOPe Domain Sequences for d1l3ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3ya1 g.3.11.6 (A:1-40) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
ecdtinceryngqvcggpgrglcfcgkcrchpgfegsacq

SCOPe Domain Coordinates for d1l3ya1:

Click to download the PDB-style file with coordinates for d1l3ya1.
(The format of our PDB-style files is described here.)

Timeline for d1l3ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l3ya2