Lineage for d1l3wa5 (1l3w A:434-540)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037193Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2037194Protein C-cadherin ectodomain [74851] (1 species)
    five-domain fragment
  7. 2037195Species African clawed frog (Xenopus laevis) [TaxId:8355] [74852] (1 PDB entry)
  8. 2037200Domain d1l3wa5: 1l3w A:434-540 [73557]
    complexed with ca, nag, ndg

Details for d1l3wa5

PDB Entry: 1l3w (more details), 3.08 Å

PDB Description: c-cadherin ectodomain
PDB Compounds: (A:) EP-cadherin

SCOPe Domain Sequences for d1l3wa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ndngpvpsprvftmcdqnpepqvltisdadippntypykvslshgsdltwkaeldskgts
mllsptqqlkkgdysiyvllsdaqnnpqltvvnatvcscegkaikcq

SCOPe Domain Coordinates for d1l3wa5:

Click to download the PDB-style file with coordinates for d1l3wa5.
(The format of our PDB-style files is described here.)

Timeline for d1l3wa5: