Lineage for d1l3wa4 (1l3w A:327-433)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768942Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1768943Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1768944Protein C-cadherin ectodomain [74851] (1 species)
    five-domain fragment
  7. 1768945Species African clawed frog (Xenopus laevis) [TaxId:8355] [74852] (1 PDB entry)
  8. 1768949Domain d1l3wa4: 1l3w A:327-433 [73556]
    complexed with ca, nag, ndg

Details for d1l3wa4

PDB Entry: 1l3w (more details), 3.08 Å

PDB Description: C-cadherin Ectodomain
PDB Compounds: (A:) EP-cadherin

SCOPe Domain Sequences for d1l3wa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]}
neapffvpavsrvdvsedlsrgekiislvaqdpdkqqiqklsyfigndparwltvnkdng
ivtgngnldreseyvknntytvimlvtddgvsvgtgtgtlilhvldv

SCOPe Domain Coordinates for d1l3wa4:

Click to download the PDB-style file with coordinates for d1l3wa4.
(The format of our PDB-style files is described here.)

Timeline for d1l3wa4: