Lineage for d1l3oa_ (1l3o A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544896Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 544897Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 544898Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)
  6. 544942Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
    contains three heme groups; deletion of one of Cyt c3 heme-binding sites
  7. 544943Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries)
  8. 544945Domain d1l3oa_: 1l3o A: [73551]
    complexed with hec; mutant

Details for d1l3oa_

PDB Entry: 1l3o (more details)

PDB Description: solution structure determination of the fully oxidized double mutant k9-10a cytochrome c7 from desulfuromonas acetoxidans, ensemble of 35 structures

SCOP Domain Sequences for d1l3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3oa_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans}
advvtyenaagnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik

SCOP Domain Coordinates for d1l3oa_:

Click to download the PDB-style file with coordinates for d1l3oa_.
(The format of our PDB-style files is described here.)

Timeline for d1l3oa_: