SCOP 1.65: Domain d1l3nb_: 1l3n B:

Lineage for d1l3nb_ (1l3n B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (16 PDB entries)

8. Domain d1l3nb_: 1l3n B: [73550]
   complexed with cu1, zn; mutant

Details for d1l3nb_

PDB Entry: 1l3n

PDB Description: the solution structure of reduced dimeric copper zinc sod: the structural effects of dimerization

SCOP Domain Sequences for d1l3nb_:

Sequence; same for both SEQRES and ATOM records:

>d1l3nb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Timeline for d1l3nb_:

• d1l3nb_ first appeared in SCOP 1.61
  
• d1l3nb_ appears in SCOP 1.63
  
• d1l3nb_ appears in SCOP 1.67
  
• d1l3nb_ appears in the current release, SCOPe 2.08