Lineage for d1l3na_ (1l3n A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658038Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 658039Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 658052Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 658133Species Human (Homo sapiens) [TaxId:9606] [49333] (27 PDB entries)
  8. 658241Domain d1l3na_: 1l3n A: [73549]

Details for d1l3na_

PDB Entry: 1l3n (more details)

PDB Description: the solution structure of reduced dimeric copper zinc sod: the structural effects of dimerization
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOP Domain Sequences for d1l3na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3na_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOP Domain Coordinates for d1l3na_:

Click to download the PDB-style file with coordinates for d1l3na_.
(The format of our PDB-style files is described here.)

Timeline for d1l3na_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l3nb_