SCOP 1.67: Domain d1l3na_: 1l3n A:

Lineage for d1l3na_ (1l3n A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (22 PDB entries)

8. Domain d1l3na_: 1l3n A: [73549]

Details for d1l3na_

PDB Entry: 1l3n

PDB Description: the solution structure of reduced dimeric copper zinc sod: the structural effects of dimerization

SCOP Domain Sequences for d1l3na_:

Sequence; same for both SEQRES and ATOM records:

>d1l3na_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Timeline for d1l3na_:

• d1l3na_ first appeared in SCOP 1.61
  
• d1l3na_ appears in SCOP 1.65
  
• d1l3na_ appears in SCOP 1.69
  
• d1l3na_ appears in the current release, SCOPe 2.08