SCOPe 2.07: Domain d1l3lc2: 1l3l C:1-162

Lineage for d1l3lc2 (1l3l C:1-162)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.5: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75516] (1 family)
   alpha(2)-beta(2)-alpha(2)-beta(3)-alpha; possibly related to the PAS domain
   automatically mapped to Pfam PF03472

5. Family d.110.5.1: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75517] (1 protein)

6. Protein Transcription factor TraR, N-terminal domain [75518] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [75519] (2 PDB entries)

8. Domain d1l3lc2: 1l3l C:1-162 [73546]
   Other proteins in same PDB: d1l3la1, d1l3lb1, d1l3lc1, d1l3ld1
   protein/DNA complex; complexed with lae

Details for d1l3lc2

PDB Entry: 1l3l, 1.66 Å

PDB Description: crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna

PDB Compounds: (C:) transcriptional activator protein trar

SCOPe Domain Sequences for d1l3lc2:

Sequence; same for both SEQRES and ATOM records:

>d1l3lc2 d.110.5.1 (C:1-162) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
mqhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqst
yfdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikt
angfmsmftmasdkpvidldreidavaaaatigqiharisfl

Timeline for d1l3lc2:

• d1l3lc2 first appeared in SCOP 1.61
  
• d1l3lc2 appears in SCOPe 2.06
  
• d1l3lc2 appears in the current release, SCOPe 2.08