Lineage for d1l3lc1 (1l3l C:172-234)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260359Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1260391Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 1260417Protein Quorum-sensing transcription factor TraR, C-terminal domain [74690] (1 species)
  7. 1260418Species Agrobacterium tumefaciens [TaxId:358] [74691] (2 PDB entries)
  8. 1260421Domain d1l3lc1: 1l3l C:172-234 [73545]
    Other proteins in same PDB: d1l3la2, d1l3lb2, d1l3lc2, d1l3ld2
    protein/DNA complex; complexed with lae

Details for d1l3lc1

PDB Entry: 1l3l (more details), 1.66 Å

PDB Description: crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna
PDB Compounds: (C:) transcriptional activator protein trar

SCOPe Domain Sequences for d1l3lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3lc1 a.4.6.2 (C:172-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
awldpkeatylrwiavgktmeeiadvegvkynsvrvklreamkrfdvrskahltalairr
kli

SCOPe Domain Coordinates for d1l3lc1:

Click to download the PDB-style file with coordinates for d1l3lc1.
(The format of our PDB-style files is described here.)

Timeline for d1l3lc1: