![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.5: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75516] (1 family) ![]() alpha(2)-beta(2)-alpha(2)-beta(3)-alpha; possibly related to the PAS domain automatically mapped to Pfam PF03472 |
![]() | Family d.110.5.1: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75517] (1 protein) |
![]() | Protein Transcription factor TraR, N-terminal domain [75518] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [75519] (2 PDB entries) |
![]() | Domain d1l3la2: 1l3l A:2-169 [73542] Other proteins in same PDB: d1l3la1, d1l3lb1, d1l3lc1, d1l3ld1 protein/DNA complex; complexed with lae |
PDB Entry: 1l3l (more details), 1.66 Å
SCOPe Domain Sequences for d1l3la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3la2 d.110.5.1 (A:2-169) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} qhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqsty fdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikta ngfmsmftmasdkpvidldreidavaaaatigqiharisflrttptae
Timeline for d1l3la2: