![]() | Class a: All alpha proteins [46456] (151 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) ![]() |
![]() | Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (3 proteins) |
![]() | Protein Quorum-sensing transcription factor TraR, C-terminal domain [74690] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [74691] (1 PDB entry) |
![]() | Domain d1l3la1: 1l3l A:172-234 [73541] Other proteins in same PDB: d1l3la2, d1l3lb2, d1l3lc2, d1l3ld2 |
PDB Entry: 1l3l (more details), 1.66 Å
SCOP Domain Sequences for d1l3la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3la1 a.4.6.2 (A:172-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens} awldpkeatylrwiavgktmeeiadvegvkynsvrvklreamkrfdvrskahltalairr kli
Timeline for d1l3la1: