Lineage for d1l3ka2 (1l3k A:103-181)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329138Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 329139Family d.58.7.1: Canonical RBD [54929] (16 proteins)
  6. 329179Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. 329180Species Human (Homo sapiens) [TaxId:9606] [54931] (4 PDB entries)
  8. 329182Domain d1l3ka2: 1l3k A:103-181 [73540]

Details for d1l3ka2

PDB Entry: 1l3k (more details), 1.1 Å

PDB Description: up1, the two rna-recognition motif domain of hnrnp a1

SCOP Domain Sequences for d1l3ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens)}
tvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdki
viqkyhtvnghncevrkal

SCOP Domain Coordinates for d1l3ka2:

Click to download the PDB-style file with coordinates for d1l3ka2.
(The format of our PDB-style files is described here.)

Timeline for d1l3ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l3ka1