![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species) duplication: contains two domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries) Uniprot P09651 7-188 |
![]() | Domain d1l3ka2: 1l3k A:103-181 [73540] |
PDB Entry: 1l3k (more details), 1.1 Å
SCOPe Domain Sequences for d1l3ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} tvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdki viqkyhtvnghncevrkal
Timeline for d1l3ka2: