Class g: Small proteins [56992] (66 folds) |
Fold g.53: TAZ domain [57932] (1 superfamily) all-alpha fold; Zn-binding sites are in the loops connecting helices |
Superfamily g.53.1: TAZ domain [57933] (1 family) |
Family g.53.1.1: TAZ domain [57934] (1 protein) |
Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [75696] (2 PDB entries) |
Domain d1l3eb_: 1l3e B: [73536] Other proteins in same PDB: d1l3ea_ CH1 (TAZ1) domain; complexed with the C-terminal activation domain (CTAD) of human HIF-1alpha (chain A) complexed with zn |
PDB Entry: 1l3e (more details)
SCOP Domain Sequences for d1l3eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3eb_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens)} mgsgahtadpekrkliqqqlvlllhahkcqrreqangevrqcnlphcrtmknvlnhmthc qsgkscqvahcassrqiishwknctrhdcpvclplknagdk
Timeline for d1l3eb_: