Lineage for d1l3ea_ (1l3e A:)

  1. Root: SCOP 1.67
  2. 434008Class j: Peptides [58231] (111 folds)
  3. 435371Fold j.96: Transactivation domain [81275] (1 superfamily)
  4. 435372Superfamily j.96.1: Transactivation domain [74800] (1 family) (S)
  5. 435373Family j.96.1.1: Transactivation domain [74801] (2 proteins)
  6. 435374Protein C-terminal activation domain (CTAD) of HIF-1alpha [74802] (1 species)
  7. 435375Species Human (Homo sapiens) [TaxId:9606] [74803] (4 PDB entries)
  8. 435378Domain d1l3ea_: 1l3e A: [73535]
    Other proteins in same PDB: d1l3eb_
    complexed with TAZ1 domain of human CBP
    complexed with zn

Details for d1l3ea_

PDB Entry: 1l3e (more details)

PDB Description: nmr structures of the hif-1alpha ctad/p300 ch1 complex

SCOP Domain Sequences for d1l3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3ea_ j.96.1.1 (A:) C-terminal activation domain (CTAD) of HIF-1alpha {Human (Homo sapiens)}
gsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn

SCOP Domain Coordinates for d1l3ea_:

Click to download the PDB-style file with coordinates for d1l3ea_.
(The format of our PDB-style files is described here.)

Timeline for d1l3ea_:

435378
d1l3ea_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1l3eb_