Lineage for d1l3ab_ (1l3a B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2162927Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 2162928Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 2162944Family d.18.1.2: Plant transcriptional regulator PBF-2 [75375] (2 protein domains)
    single-chain domain formed by a tandem repeat of two motifs
  6. 2162945Protein Plant transcriptional regulator PBF-2 [75376] (1 species)
  7. 2162946Species Potato (Solanum tuberosum) [TaxId:4113] [75377] (1 PDB entry)
  8. 2162948Domain d1l3ab_: 1l3a B: [73532]
    Other proteins in same PDB: d1l3ac2

Details for d1l3ab_

PDB Entry: 1l3a (more details), 2.3 Å

PDB Description: Structure of the plant transcriptional regulator PBF-2
PDB Compounds: (B:) p24: plant transcriptional regulator PBF-2

SCOPe Domain Sequences for d1l3ab_:

Sequence, based on SEQRES records: (download)

>d1l3ab_ d.18.1.2 (B:) Plant transcriptional regulator PBF-2 {Potato (Solanum tuberosum) [TaxId: 4113]}
tpkvfvgysiykgkaaltveprspefspldsgafklsregmvmlqfapaagvrqydwsrk
qvfslsvteigsiislgtkdsceffhdpnkgrsdegrvrkvlkveplpdgsghffnlsvq
nklinldeniyipvtkaefavlvsafnfvmpyllgwhtavnsfkpedasrsnnanprsga
ele

Sequence, based on observed residues (ATOM records): (download)

>d1l3ab_ d.18.1.2 (B:) Plant transcriptional regulator PBF-2 {Potato (Solanum tuberosum) [TaxId: 4113]}
tpkvfvgysiykgkaaltveprspefspldsgafklsregmvmlqfapaagvrqydwsrk
qvfslsvteigsiislgtkdsceffhdpnkgrsdegrvrkvlkveplpdgsghffnlsvq
nklinldeniyipvtkaefavlvsafnfvmpyllgwhtavnsfkpeaele

SCOPe Domain Coordinates for d1l3ab_:

Click to download the PDB-style file with coordinates for d1l3ab_.
(The format of our PDB-style files is described here.)

Timeline for d1l3ab_: