Lineage for d1l3aa_ (1l3a A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719299Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 719300Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (4 families) (S)
  5. 719316Family d.18.1.2: Plant transcriptional regulator PBF-2 [75375] (1 protein)
    single-chain domain formed by a tandem repeat of two motifs
  6. 719317Protein Plant transcriptional regulator PBF-2 [75376] (1 species)
  7. 719318Species Potato (Solanum tuberosum) [TaxId:4113] [75377] (1 PDB entry)
  8. 719319Domain d1l3aa_: 1l3a A: [73531]

Details for d1l3aa_

PDB Entry: 1l3a (more details), 2.3 Å

PDB Description: structure of the plant transcriptional regulator pbf-2
PDB Compounds: (A:) p24: plant transcriptional regulator PBF-2

SCOP Domain Sequences for d1l3aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3aa_ d.18.1.2 (A:) Plant transcriptional regulator PBF-2 {Potato (Solanum tuberosum) [TaxId: 4113]}
tpkvfvgysiykgkaaltveprspefspldsgafklsregmvmlqfapaagvrqydwsrk
qvfslsvteigsiislgtkdsceffhdpnkgrsdegrvrkvlkveplpdgsghffnlsvq
nklinldeniyipvtkaefavlvsafnfvmpyllgwhtavnsfkpe

SCOP Domain Coordinates for d1l3aa_:

Click to download the PDB-style file with coordinates for d1l3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1l3aa_: