Lineage for d1l2ua_ (1l2u A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079188Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2079202Species Escherichia coli [TaxId:562] [51378] (3 PDB entries)
  8. 2079207Domain d1l2ua_: 1l2u A: [73516]

Details for d1l2ua_

PDB Entry: 1l2u (more details), 2.5 Å

PDB Description: Orotidine 5'-monophosphate decarboxylase from E. coli
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1l2ua_:

Sequence, based on SEQRES records: (download)

>d1l2ua_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]}
avtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifl
dlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvl
tsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpg
irpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslqr

Sequence, based on observed residues (ATOM records): (download)

>d1l2ua_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]}
avtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifl
dlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvl
tsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpg
irpqimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslqr

SCOPe Domain Coordinates for d1l2ua_:

Click to download the PDB-style file with coordinates for d1l2ua_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l2ub_