Lineage for d1l2na_ (1l2n A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1017617Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1017711Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 1017712Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (3 PDB entries)
  8. 1017716Domain d1l2na_: 1l2n A: [73508]

Details for d1l2na_

PDB Entry: 1l2n (more details)

PDB Description: Smt3 Solution Structure
PDB Compounds: (A:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d1l2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2na_ d.15.1.1 (A:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
ethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtped
ldmedndiieahreqi

SCOPe Domain Coordinates for d1l2na_:

Click to download the PDB-style file with coordinates for d1l2na_.
(The format of our PDB-style files is described here.)

Timeline for d1l2na_: