Lineage for d1l2na_ (1l2n A:)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) 
Family d.15.1.1: Ubiquitin-related [54237] (14 proteins) 
Protein SUMO-1 (smt3 homologue) [54241] (2 species) Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (2 PDB entries) 
Domain d1l2na_: 1l2n A: [73508]
Details for d1l2na_
PDB Entry: 1l2n (more details)
PDB Description: smt3 solution structure
SCOP Domain Sequences for d1l2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2na_ d.15.1.1 (A:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3}
ethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtped
ldmedndiieahreqi
SCOP Domain Coordinates for d1l2na_:
Click to download the PDB-style file with coordinates for d1l2na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l2na_:
- d1l2na_ first appeared in SCOP 1.61
- d1l2na_ appears in SCOP 1.65
- d1l2na_ appears in SCOP 1.69
- d1l2na_ appears in the current release, SCOPe 2.08
View in 3D