Lineage for d1l2na_ (1l2n A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189215Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 189216Family d.15.1.1: Ubiquitin-related [54237] (6 proteins)
  6. 189234Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 189235Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (2 PDB entries)
  8. 189237Domain d1l2na_: 1l2n A: [73508]

Details for d1l2na_

PDB Entry: 1l2n (more details)

PDB Description: smt3 solution structure

SCOP Domain Sequences for d1l2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2na_ d.15.1.1 (A:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3}
ethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtped
ldmedndiieahreqi

SCOP Domain Coordinates for d1l2na_:

Click to download the PDB-style file with coordinates for d1l2na_.
(The format of our PDB-style files is described here.)

Timeline for d1l2na_: