SCOPe 2.04: Domain d1l2ka_: 1l2k A:

Lineage for d1l2ka_ (1l2k A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (239 PDB entries)
   Uniprot P02185

8. Domain d1l2ka_: 1l2k A: [73507]
   complexed with dod, hem, nd4, so4

Details for d1l2ka_

PDB Entry: 1l2k, 1.5 Å

PDB Description: Neutron Structure Determination of Sperm Whale Met-Myoglobin at 1.5A Resolution.

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1l2ka_:

Sequence; same for both SEQRES and ATOM records:

>d1l2ka_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgy

Timeline for d1l2ka_:

• d1l2ka_ first appeared in SCOP 1.61
  
• d1l2ka_ appears in SCOPe 2.03
  
• d1l2ka_ appears in SCOPe 2.05
  
• d1l2ka_ appears in the current release, SCOPe 2.08