Lineage for d1l2ja_ (1l2j A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156240Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 156241Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 156242Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (17 proteins)
  6. 156273Protein Estrogen receptor beta [48521] (2 species)
  7. 156274Species Human (Homo sapiens) [TaxId:9606] [48522] (2 PDB entries)
  8. 156276Domain d1l2ja_: 1l2j A: [73505]

Details for d1l2ja_

PDB Entry: 1l2j (more details), 2.95 Å

PDB Description: Human Estrogen Receptor beta Ligand-binding Domain in Complex with (R,R)-5,11-cis-diethyl-5,6,11,12-tetrahydrochrysene-2,8-diol

SCOP Domain Sequences for d1l2ja_:

Sequence, based on SEQRES records: (download)

>d1l2ja_ a.123.1.1 (A:) Estrogen receptor beta {Human (Homo sapiens)}
dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
r

Sequence, based on observed residues (ATOM records): (download)

>d1l2ja_ a.123.1.1 (A:) Estrogen receptor beta {Human (Homo sapiens)}
dalspeqlvltlleaepphvlisrteasmmmsltkladkelvhmiswakkipgfvelslf
dqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllatts
rfrelklqhkeylcvkamillnslvtatqdadssrklahllnavtdalvwviaksgissq
qqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvlr

SCOP Domain Coordinates for d1l2ja_:

Click to download the PDB-style file with coordinates for d1l2ja_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ja_: