Lineage for d1l2ac_ (1l2a C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358916Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 358917Superfamily a.102.1: Six-hairpin glycosidases [48208] (6 families) (S)
  5. 358929Family a.102.1.2: Cellulases catalytic domain [48213] (8 proteins)
  6. 358975Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 358985Species Clostridium thermocellum [TaxId:1515] [74765] (2 PDB entries)
  8. 358994Domain d1l2ac_: 1l2a C: [73495]

Details for d1l2ac_

PDB Entry: 1l2a (more details), 2.5 Å

PDB Description: the crystal structure and catalytic mechanism of cellobiohydrolase cels, the major enzymatic component of the clostridium thermocellum cellulosome

SCOP Domain Sequences for d1l2ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ac_ a.102.1.2 (C:) Processive endocellulase CelF (Cel48F) {Clostridium thermocellum}
gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp

SCOP Domain Coordinates for d1l2ac_:

Click to download the PDB-style file with coordinates for d1l2ac_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ac_: