Lineage for d1l2aa_ (1l2a A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155275Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 155276Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (4 families) (S)
  5. 155288Family a.102.1.2: Cellulases catalytic domain [48213] (4 proteins)
  6. 155306Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 155314Species Clostridium thermocellum [TaxId:1515] [74765] (2 PDB entries)
  8. 155321Domain d1l2aa_: 1l2a A: [73493]

Details for d1l2aa_

PDB Entry: 1l2a (more details), 2.5 Å

PDB Description: the crystal structure and catalytic mechanism of cellobiohydrolase cels, the major enzymatic component of the clostridium thermocellum cellulosome

SCOP Domain Sequences for d1l2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2aa_ a.102.1.2 (A:) Processive endocellulase CelF (Cel48F) {Clostridium thermocellum}
gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp

SCOP Domain Coordinates for d1l2aa_:

Click to download the PDB-style file with coordinates for d1l2aa_.
(The format of our PDB-style files is described here.)

Timeline for d1l2aa_: