Lineage for d1l1yf_ (1l1y F:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216372Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 216373Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (5 families) (S)
  5. 216385Family a.102.1.2: Cellulases catalytic domain [48213] (6 proteins)
  6. 216413Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 216421Species Clostridium thermocellum [TaxId:1515] [74765] (2 PDB entries)
  8. 216427Domain d1l1yf_: 1l1y F: [73491]
    complexed with bgc

Details for d1l1yf_

PDB Entry: 1l1y (more details), 2.4 Å

PDB Description: the crystal structure and catalytic mechanism of cellobiohydrolase cels, the major enzymatic component of the clostridium thermocellum cellulosome

SCOP Domain Sequences for d1l1yf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1yf_ a.102.1.2 (F:) Processive endocellulase CelF (Cel48F) {Clostridium thermocellum}
gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp

SCOP Domain Coordinates for d1l1yf_:

Click to download the PDB-style file with coordinates for d1l1yf_.
(The format of our PDB-style files is described here.)

Timeline for d1l1yf_: