Lineage for d1l1yd_ (1l1y D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335152Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2335214Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 2335225Species Clostridium thermocellum [TaxId:1515] [74765] (2 PDB entries)
  8. 2335229Domain d1l1yd_: 1l1y D: [73489]

Details for d1l1yd_

PDB Entry: 1l1y (more details), 2.4 Å

PDB Description: the crystal structure and catalytic mechanism of cellobiohydrolase cels, the major enzymatic component of the clostridium thermocellum cellulosome
PDB Compounds: (D:) cellobiohydrolase

SCOPe Domain Sequences for d1l1yd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1yd_ a.102.1.2 (D:) Processive endocellulase CelF (Cel48F) {Clostridium thermocellum [TaxId: 1515]}
gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp

SCOPe Domain Coordinates for d1l1yd_:

Click to download the PDB-style file with coordinates for d1l1yd_.
(The format of our PDB-style files is described here.)

Timeline for d1l1yd_: