Lineage for d1l1yc_ (1l1y C:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284240Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (6 families) (S)
  5. 284252Family a.102.1.2: Cellulases catalytic domain [48213] (7 proteins)
  6. 284294Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 284304Species Clostridium thermocellum [TaxId:1515] [74765] (2 PDB entries)
  8. 284307Domain d1l1yc_: 1l1y C: [73488]

Details for d1l1yc_

PDB Entry: 1l1y (more details), 2.4 Å

PDB Description: the crystal structure and catalytic mechanism of cellobiohydrolase cels, the major enzymatic component of the clostridium thermocellum cellulosome

SCOP Domain Sequences for d1l1yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1yc_ a.102.1.2 (C:) Processive endocellulase CelF (Cel48F) {Clostridium thermocellum}
gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp

SCOP Domain Coordinates for d1l1yc_:

Click to download the PDB-style file with coordinates for d1l1yc_.
(The format of our PDB-style files is described here.)

Timeline for d1l1yc_: