SCOP 1.61: Domain d1l1oe_: 1l1o E:

Lineage for d1l1oe_ (1l1o E:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (7 proteins)

6. Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50270] (2 PDB entries)

8. Domain d1l1oe_: 1l1o E: [73482]
   Other proteins in same PDB: d1l1oa_, d1l1oc_, d1l1od_, d1l1of_

Details for d1l1oe_

PDB Entry: 1l1o, 2.8 Å

PDB Description: Structure of the human Replication Protein A (RPA) trimerization core

SCOP Domain Sequences for d1l1oe_:

Sequence, based on SEQRES records:

>d1l1oe_ b.40.4.3 (E:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
nahmvlsk

Sequence, based on observed residues (ATOM records):

>d1l1oe_ b.40.4.3 (E:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtdntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmv
lsk

Timeline for d1l1oe_:

• d1l1oe_ is new in SCOP 1.61
  
• d1l1oe_ appears in SCOP 1.63
  
• d1l1oe_ appears in the current release, SCOPe 2.08