Lineage for d1l1oe_ (1l1o E:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166823Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (7 proteins)
  6. 166837Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 166838Species Human (Homo sapiens) [TaxId:9606] [50270] (2 PDB entries)
  8. 166842Domain d1l1oe_: 1l1o E: [73482]
    Other proteins in same PDB: d1l1oa_, d1l1oc_, d1l1od_, d1l1of_

Details for d1l1oe_

PDB Entry: 1l1o (more details), 2.8 Å

PDB Description: Structure of the human Replication Protein A (RPA) trimerization core

SCOP Domain Sequences for d1l1oe_:

Sequence, based on SEQRES records: (download)

>d1l1oe_ b.40.4.3 (E:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
nahmvlsk

Sequence, based on observed residues (ATOM records): (download)

>d1l1oe_ b.40.4.3 (E:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtdntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmv
lsk

SCOP Domain Coordinates for d1l1oe_:

Click to download the PDB-style file with coordinates for d1l1oe_.
(The format of our PDB-style files is described here.)

Timeline for d1l1oe_: