Lineage for d1l1oe_ (1l1o E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051200Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 protein domains)
    barrel, closed; n=5, S=10
  6. 2051268Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 2051269Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)
  8. 2051281Domain d1l1oe_: 1l1o E: [73482]
    Other proteins in same PDB: d1l1oa_, d1l1oc_, d1l1od_, d1l1of_
    complexed with zn

Details for d1l1oe_

PDB Entry: 1l1o (more details), 2.8 Å

PDB Description: Structure of the human Replication Protein A (RPA) trimerization core
PDB Compounds: (E:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d1l1oe_:

Sequence, based on SEQRES records: (download)

>d1l1oe_ b.40.4.3 (E:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
nahmvlsk

Sequence, based on observed residues (ATOM records): (download)

>d1l1oe_ b.40.4.3 (E:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtdntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmv
lsk

SCOPe Domain Coordinates for d1l1oe_:

Click to download the PDB-style file with coordinates for d1l1oe_.
(The format of our PDB-style files is described here.)

Timeline for d1l1oe_: