![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50272] (2 PDB entries) |
![]() | Domain d1l1od_: 1l1o D: [73481] Other proteins in same PDB: d1l1ob_, d1l1oc_, d1l1oe_, d1l1of_ complexed with zn |
PDB Entry: 1l1o (more details), 2.8 Å
SCOP Domain Sequences for d1l1od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1od_ b.40.4.3 (D:) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens)} dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi
Timeline for d1l1od_: